CacheBy
Atlas Antibodies Anti-LEXM Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LEXM Antibody

상품 한눈에 보기

인간 LEXM 단백질을 표적으로 하는 폴리클로날 항체. 면역조직화학(IHC) 및 웨스턴블롯(WB)에 적합. 재조합 단백질 발현 기반 검증 완료. 토끼 유래 IgG, PrEST 항원 친화 정제. PBS/글리세롤 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035890-100 Anti-LEXM Antibody, lymphocyte expansion molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035890-25 Anti-LEXM Antibody, lymphocyte expansion molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LEXM Antibody

Anti-LEXM Antibody

Target: lymphocyte expansion molecule (LEXM)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against human LEXM.


Alternative Gene Names

C1orf177, FLJ40201, LEM

Open Datasheet (PDF)


Antigen Information

항목 내용
Target Protein lymphocyte expansion molecule
Target Gene LEXM
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000030914 (71%), Mouse ENSMUSG00000054362 (71%)

Antigen Sequence:

SHRFDISAVYPNWKKFSTFTEAPYSTRYSTQVSHIGPGTYSSKETCFSKKKLMKEVDTGWAKAQEATRLTQLPHFQYQAIMKEKRLKEQKLGPGSYNLKDFL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.