CacheBy
Atlas Antibodies Anti-LCOR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LCOR Antibody

상품 한눈에 보기

Human LCOR 단백질을 인식하는 토끼 폴리클로날 항체로, WB 등 다양한 응용에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, 높은 종간 보존성을 보임. 40% glycerol 기반 buffer에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057621-100 Anti-LCOR Antibody, ligand dependent nuclear receptor corepressor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057621-25 Anti-LCOR Antibody, ligand dependent nuclear receptor corepressor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LCOR Antibody

Anti-LCOR Antibody

Target Protein: ligand dependent nuclear receptor corepressor
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human LCOR (ligand dependent nuclear receptor corepressor).
Validated for use in Western Blot (WB) and other applications.


Alternative Gene Names

FLJ38026, KIAA1795, MLR2


Target Information

항목 내용
Target Gene LCOR
Target Protein ligand dependent nuclear receptor corepressor
Verified Species Reactivity Human
Interspecies Homology Mouse (94%), Rat (93%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWE

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.