CacheBy
Atlas Antibodies Anti-LCOR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LCOR Antibody

상품 한눈에 보기

인간 LCOR 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit 호스트에서 생산되며, WB 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 서열 유사성을 가집니다. 안정적인 PBS/glycerol 버퍼로 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077000-100 Anti-LCOR Antibody, ligand dependent nuclear receptor corepressor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077000-25 Anti-LCOR Antibody, ligand dependent nuclear receptor corepressor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LCOR Antibody

Anti-LCOR Antibody

Target Information

  • Target Protein: Ligand dependent nuclear receptor corepressor
  • Target Gene: LCOR
  • Alternative Gene Names: FLJ38026, KIAA1795, MLR2

Product Description

Polyclonal antibody against human LCOR.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000025019 94%
Rat ENSRNOG00000042679 93%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Western Blot (WB)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Recommended Applications - WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.