CacheBy
Atlas Antibodies Anti-LCN10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LCN10 Antibody

상품 한눈에 보기

Human LCN10을 인식하는 rabbit polyclonal antibody로, PrEST 항원을 이용해 정제됨. IHC 등 다양한 응용에 적합하며, 40% glycerol 기반 PBS buffer에 보존제 포함. 인간에 대해 검증된 반응성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055919-100 Anti-LCN10 Antibody, lipocalin 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055919-25 Anti-LCN10 Antibody, lipocalin 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LCN10 Antibody

Anti-LCN10 Antibody

Target: lipocalin 10 (LCN10)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human LCN10.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein lipocalin 10
Target Gene LCN10
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence GHLWASLSVKGVKAFHVLSTDYSYGLVYLRLGRATQNYKNLLLFHRQNVSSFQSLKEFMDACDILGLSKAAVILPKDASRTHTI

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000028074 (65%)
Mouse ENSMUSG00000047356 (65%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Material Safety Data Sheet MSDS - Sodium Azide

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.