
1 / 2
Atlas Antibodies Anti-ABHD13 Antibody
상품 한눈에 보기
Human ABHD13 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB(재조합 발현 검증), ICC에 적합합니다. 고순도의 Affinity 정제 방식으로 제조되었으며, 높은 종간 보존성과 신뢰성 있는 실험 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ABHD13 Antibody
abhydrolase domain containing 13
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human ABHD13
Alternative Gene Names
bA153I24.2, BEM46L1, C13orf6, FLJ14906
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | abhydrolase domain containing 13 |
| Target Gene | ABHD13 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVVK |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000040396 (99%), Rat ENSRNOG00000014598 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ABHD14B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABHD14A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABHD13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABHD13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ABHD12B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.