
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ABHD12B Antibody
상품 한눈에 보기
Human ABHD12B 단백질을 인식하는 폴리클로날 토끼 항체. IHC 및 WB에 적합하며, PrEST 항원으로 친화 정제됨. 40% 글리세롤 PBS 버퍼에 보존제로 sodium azide 포함. 다양한 종 간 교차 반응성 정보 제공.
- 카탈로그번호
- HPA002873-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA002873-100 Anti-ABHD12B Antibody, abhydrolase domain containing 12B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002873-25 Anti-ABHD12B Antibody, abhydrolase domain containing 12B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ABHD12B Antibody
Anti-ABHD12B Antibody
Target: abhydrolase domain containing 12B
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human ABHD12B
Alternative Gene Names
- BEM46L3
- C14orf29
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | abhydrolase domain containing 12B |
| Target Gene | ABHD12B |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (80%), Rat (44%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQ
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



