CacheBy
Atlas Antibodies Anti-ABHD14A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ABHD14A Antibody

상품 한눈에 보기

인간 ABHD14A 단백질을 표적으로 하는 폴리클로날 항체입니다. 토끼에서 생산되었으며 IgG 아이소타입을 가집니다. PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증되었으며 마우스 및 랫트와 높은 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038153-100 Anti-ABHD14A Antibody, abhydrolase domain containing 14A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038153-25 Anti-ABHD14A Antibody, abhydrolase domain containing 14A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ABHD14A Antibody

Anti-ABHD14A Antibody

Target: abhydrolase domain containing 14A (ABHD14A)
Supplier: Atlas Antibodies


ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against human ABHD14A.


Alternative Gene Names

  • DKFZP564O243
  • DORZ1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein abhydrolase domain containing 14A
Target Gene ABHD14A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PEQTSCLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000042210 (81%), Rat ENSRNOG00000011936 (78%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.