CacheBy
Atlas Antibodies Anti-LAMTOR3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LAMTOR3 Antibody

상품 한눈에 보기

인간 LAMTOR3 단백질을 인식하는 폴리클로날 항체로, MAPK 및 mTOR 활성화 관련 연구에 적합합니다. Rabbit 유래 IgG 항체이며, IHC 및 WB 응용에 추천됩니다. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026858-100 Anti-LAMTOR3 Antibody, late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026858-25 Anti-LAMTOR3 Antibody, late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LAMTOR3 Antibody

Anti-LAMTOR3 Antibody

Target: late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human LAMTOR3.


Alternative Gene Names

MAP2K1IP1, MAPBP, MAPKSP1, MP1, Ragulator3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
Target Gene LAMTOR3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000091512 (98%), Rat ENSRNOG00000010552 (97%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.