CacheBy
Thermo Fisher Scientific CD5 Polyclonal Antibody
원본

Thermo Fisher Scientific CD5 Polyclonal Antibody

상품 한눈에 보기

CD5 단백질을 표적하는 Rabbit Polyclonal 항체로, Western blot 및 Flow cytometry에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 후 500 µg/mL 농도로 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 03:54
Thermo Fisher Scientific PA578989 CD5 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific CD5 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL
  • Publications: -

Flow Cytometry (Flow)

  • Tested Dilution: 1–3 µg/1×10^6 cells
  • Publications: -

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 4 mg trehalose
Contains No preservative
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2746105

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

CD5는 67 kDa 크기의 인간 T-림프구 단일사슬 막관통 당단백질입니다.
모든 성숙 T-림프구, 대부분의 흉선세포, 다수의 T세포 백혈병 및 림프종에서 발현됩니다.
CD5는 활성화된 B세포의 일부 아형에서도 반응하며, T세포 증식 조절에 관여하는 수용체로 작용할 수 있습니다.
흉선세포의 약 95%, 말초혈액 림프구의 약 72%에서 발현되며, 림프절에서는 주로 T세포 영역에서 반응성이 관찰됩니다.
CD5 발현 이상은 흉선암 및 Richter 증후군과 관련이 있습니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.