CacheBy
Atlas Antibodies Anti-KBTBD13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KBTBD13 Antibody

상품 한눈에 보기

Human KBTBD13 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며, glycerol 기반 버퍼로 안정화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062737-100 Anti-KBTBD13 Antibody, kelch repeat and BTB (POZ) domain containing 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062737-25 Anti-KBTBD13 Antibody, kelch repeat and BTB (POZ) domain containing 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KBTBD13 Antibody

Anti-KBTBD13 Antibody

Target: kelch repeat and BTB (POZ) domain containing 13 (KBTBD13)
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구용 응용에 적합


Product Description

Polyclonal antibody against Human KBTBD13


Alternative Gene Names

hCG_1645727, NEM6

Open Datasheet


Target Information

항목 내용
Target Protein kelch repeat and BTB (POZ) domain containing 13
Target Gene KBTBD13
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000054978 (93%)
Rat ENSRNOG00000002875 (38%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LEASTLLAGVATLGNKLYIVGGVRGASKEVVELGFCYDPDGGTWHEFPSPHQPRYDTALAGFDGRLYAIG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자 실험 환경에 따라 결정되어야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.