Atlas Antibodies Anti-KBTBD3 Antibody

상품 한눈에 보기

인간 KBTBD3 단백질을 인식하는 토끼 다클론 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. 40% 글리세롤 기반 완충액에 보존되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047385-100 Anti-KBTBD3 Antibody, kelch repeat and BTB (POZ) domain containing 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047385-25 Anti-KBTBD3 Antibody, kelch repeat and BTB (POZ) domain containing 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: kelch repeat and BTB (POZ) domain containing 3
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies

Polyclonal antibody against human KBTBD3 protein.

항목	내용
Target Protein	kelch repeat and BTB (POZ) domain containing 3
Target Gene	KBTBD3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	IMDAIKCVQGSGGLFPDARPSTTEKYIFIHKTEENGENQYTFCYNIKSDSWKILPQSHLIDLPGSSLSSYGEKIFLTGGCKGKCCRTVRLHIAESYHDATDQTWCY

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000025893	94%
Rat	ENSRNOG00000022252	94%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet