Atlas Antibodies Anti-IREB2 Antibody

상품 한눈에 보기

인간 IREB2 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit에서 생산되었으며 IgG 아이소타입입니다. 다양한 응용 분야에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040371-100 Anti-IREB2 Antibody, iron-responsive element binding protein 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040371-25 Anti-IREB2 Antibody, iron-responsive element binding protein 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Iron-responsive element binding protein 2
Supplier: Atlas Antibodies

ICC (Immunocytochemistry)

Polyclonal antibody against human IREB2.

IRP2

Target Protein: Iron-responsive element binding protein 2
Target Gene: IREB2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LTVDHSLQIDFSKCAIQNAPNPGGGDLQKAGKLSPLKVQPKKLPCRGQTTCRGSCDSGELGRNSGTFSSQIENTPILCPFHLQPVPEPETVLK

Human

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000013271	98%
Mouse	ENSMUSG00000032293	97%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand