CacheBy
Atlas Antibodies Anti-IRAK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IRAK3 Antibody

상품 한눈에 보기

Human IRAK3 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 고순도, 높은 특이성, 신뢰성 있는 결과를 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043097-100 Anti-IRAK3 Antibody, interleukin-1 receptor-associated kinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043097-25 Anti-IRAK3 Antibody, interleukin-1 receptor-associated kinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IRAK3 Antibody

Anti-IRAK3 Antibody

Target: interleukin-1 receptor-associated kinase 3 (IRAK3)
Type: Polyclonal Antibody against Human IRAK3


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody targeting human IRAK3 (interleukin-1 receptor-associated kinase 3).


Alternative Gene Names

  • IRAK-M

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein interleukin-1 receptor-associated kinase 3
Target Gene IRAK3
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence SWLDVRHIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGE
Verified Species Reactivity Human
Interspecies Identity Rat (68%), Mouse (68%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.