CacheBy
Atlas Antibodies Anti-IRAK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IRAK2 Antibody

상품 한눈에 보기

Human IRAK2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합함. Rabbit 유래 IgG 항체이며 PrEST 항원으로 정제됨. 인체 반응성이 검증되어 신호전달 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050520-100 Anti-IRAK2 Antibody, interleukin-1 receptor-associated kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050520-25 Anti-IRAK2 Antibody, interleukin-1 receptor-associated kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IRAK2 Antibody

Anti-IRAK2 Antibody

Target: interleukin-1 receptor-associated kinase 2 (IRAK2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human IRAK2.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein interleukin-1 receptor-associated kinase 2
Target Gene IRAK2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000021817 (65%), Mouse ENSMUSG00000060477 (61%)

Antigen Sequence:

AFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.