Atlas Antibodies Anti-IQSEC2 Antibody

상품 한눈에 보기

Human IQSEC2 단백질을 타겟으로 하는 폴리클로날 토끼 항체입니다. Recombinant PrEST 항원으로 정제되었으며, 인간, 쥐, 생쥐 종에 높은 반응성을 보입니다. 면역세포화학 등 다양한 연구 응용에 적합합니다. PBS/glycerol buffer에 보존되어 안정적으로 사용 가능합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA076533-100 Anti-IQSEC2 Antibody, IQ motif and Sec7 domain 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA076533-25 Anti-IQSEC2 Antibody, IQ motif and Sec7 domain 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-IQSEC2 Antibody

Anti-IQSEC2 Antibody

Target Information

Target Protein: IQ motif and Sec7 domain 2
Target Gene: IQSEC2
Alternative Gene Names: KIAA0522, MRX1, MRX18, MRX78

Product Description

Polyclonal antibody against human IQSEC2, produced in rabbit and affinity purified using recombinant PrEST antigen.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

CSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat (ENSRNOG00000058975): 99%
Mouse (ENSMUSG00000041115): 99%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Recommended Applications	Immunocytochemistry (ICC)
Storage	Store at -20°C or below
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.