CacheBy
Atlas Antibodies Anti-IMMP1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IMMP1L Antibody

상품 한눈에 보기

인간 IMMP1L 단백질을 표적으로 하는 폴리클로날 항체입니다. 면역조직화학 등 다양한 응용에 적합하며, 토끼에서 생산된 IgG 형식입니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 순도를 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058308-100 Anti-IMMP1L Antibody, inner mitochondrial membrane peptidase subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058308-25 Anti-IMMP1L Antibody, inner mitochondrial membrane peptidase subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IMMP1L Antibody

Anti-IMMP1L Antibody

Target Information

  • Target Protein: Inner mitochondrial membrane peptidase subunit 1
  • Target Gene: IMMP1L
  • Alternative Gene Names: FLJ25059, IMMP1

Product Description

Polyclonal antibody against human IMMP1L.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKR

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000042670): 100%
  • Rat (ENSRNOG00000004829): 98%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Recommended Applications Immunohistochemistry (IHC)
Safety Information Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.