AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ILKAP Antibody
상품 한눈에 보기
Human ILKAP 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. ILKAP 단백질의 세린/트레오닌 인산화효소 연관 인산화효소 연구에 활용됩니다. 고순도 affinity 정제 및 인간·마우스 반응 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056099-100 Anti-ILKAP Antibody, integrin-linked kinase-associated serine/threonine phosphatase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056099-25 Anti-ILKAP Antibody, integrin-linked kinase-associated serine/threonine phosphatase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ILKAP Antibody
Anti-ILKAP Antibody
Integrin-linked kinase-associated serine/threonine phosphatase
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ILKAP.
Alternative Gene Names
- DKFZP434J2031
- FLJ10181
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Integrin-linked kinase-associated serine/threonine phosphatase |
| Target Gene | ILKAP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMVKTEGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHV |
Verified Species Reactivity
- Human
- Mouse
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000026309 | 91% |
| Rat | ENSRNOG00000020115 | 88% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.