CacheBy
Atlas Antibodies Anti-IMMT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IMMT Antibody

상품 한눈에 보기

인간 IMMT 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원 기반 특이적 결합. 인간 반응성 검증 완료, 마우스 및 랫트와 높은 서열 유사성 보유. 안정적인 PBS/glycerol 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036164-100 Anti-IMMT Antibody, inner membrane protein, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036164-25 Anti-IMMT Antibody, inner membrane protein, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IMMT Antibody

Anti-IMMT Antibody

Target: Inner membrane protein, mitochondrial
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Independent validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human IMMT.


Alternative Gene Names

HMP, MINOS2, P87, P89


Target Information

항목 내용
Target Protein Inner membrane protein, mitochondrial
Target Gene IMMT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000052337 (97%), Rat ENSRNOG00000009097 (95%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

VAMIDETRNSLYQYFLSYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARM

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

Additional Resources

Open Datasheet


제품 이미지

Enhanced Validation

IHC Orthogonal

WB Independent

ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.