CacheBy
Atlas Antibodies Anti-IL2RB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IL2RB Antibody

상품 한눈에 보기

Human IL2RB를 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. PrEST 항원으로 친화 정제되었으며, 40% glycerol과 PBS buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062657-100 Anti-IL2RB Antibody, interleukin 2 receptor, beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062657-25 Anti-IL2RB Antibody, interleukin 2 receptor, beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IL2RB Antibody

Anti-IL2RB Antibody

Target: interleukin 2 receptor, beta (IL2RB)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human IL2RB


Alternative Gene Names

CD122, IL15RB

Open Datasheet


Antigen Information

  • Target Protein: interleukin 2 receptor, beta
  • Target Gene: IL2RB
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:

DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000048636 60%
Mouse ENSMUSG00000068227 53%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.