CacheBy
Atlas Antibodies Anti-ZMAT3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZMAT3 Antibody

상품 한눈에 보기

인간 ZMAT3 단백질을 인식하는 토끼 폴리클로날 항체. IHC를 통한 단백질 발현의 정교한 교차 검증에 적합. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성을 제공. 다양한 조직 샘플에서 RNA-seq 데이터와 비교 검증 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027569-100 Anti-ZMAT3 Antibody, zinc finger matrin-type 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027569-25 Anti-ZMAT3 Antibody, zinc finger matrin-type 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZMAT3 Antibody

Anti-ZMAT3 Antibody

Target Protein: zinc finger matrin-type 3
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human ZMAT3 (zinc finger matrin-type 3).
Validated through orthogonal comparison of IHC staining and RNA-seq data from tissues with high and low expression levels.


Alternative Gene Names

FLJ12296, MGC10613, PAG608, WIG-1, WIG1

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

GPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV

Species Reactivity

Species Gene ID / Ortholog Identity
Human ZMAT3 100%
Mouse ENSMUSG00000027663 96%
Rat ENSRNOG00000010119 96%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Host Rabbit
Isotype IgG
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
Recommended Applications
Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.