CacheBy
Atlas Antibodies Anti-ZG16B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZG16B Antibody

상품 한눈에 보기

인체 ZG16B 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제되었습니다. RNA-seq 데이터 기반 Orthogonal 검증을 통해 단백질 발현 신뢰도를 보장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041125-100 Anti-ZG16B Antibody, zymogen granule protein 16B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041125-25 Anti-ZG16B Antibody, zymogen granule protein 16B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZG16B Antibody

Anti-ZG16B Antibody

Target: zymogen granule protein 16B
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human ZG16B


Alternative Gene Names

HRPE773, JCLN2, PRO1567


Target Information

항목 내용
Target Protein zymogen granule protein 16B
Target Gene ZG16B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000049350 (31%), Rat ENSRNOG00000016857 (31%)

Antigen Sequence:
AGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQA


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.