AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZG16B Antibody
상품 한눈에 보기
인체 ZG16B 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. RNA-seq 데이터 기반 Orthogonal 검증 완료. Human에 반응성이 확인되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053549-100 Anti-ZG16B Antibody, zymogen granule protein 16B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053549-25 Anti-ZG16B Antibody, zymogen granule protein 16B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZG16B Antibody
Anti-ZG16B Antibody
Target: zymogen granule protein 16B
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal Antibody against Human ZG16B
Alternative Gene Names
HRPE773, JCLN2, PRO1567
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | zymogen granule protein 16B |
| Target Gene | ZG16B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000016857 (31%), Mouse ENSMUSG00000049350 (31%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
AGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQA제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.