CacheBy
Atlas Antibodies Anti-ZG16 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZG16 Antibody

상품 한눈에 보기

인간 ZG16 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. 정제된 PrEST 항원 기반 친화 정제 방식 사용. 인간에 대한 반응성이 검증되었으며, 재조합 단백질 발현 및 RNA-seq 데이터로 교차 검증된 신뢰성 높은 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052066-100 Anti-ZG16 Antibody, zymogen granule protein 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052066-25 Anti-ZG16 Antibody, zymogen granule protein 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZG16 Antibody

Anti-ZG16 Antibody

Target: zymogen granule protein 16
Type: Polyclonal Antibody against Human ZG16


  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody recognizing Human ZG16.


Alternative Gene Names

hZG16, JCLN, JCLN1, ZG16A

Open Datasheet


Target Information

항목 내용
Target Protein zymogen granule protein 16
Target Gene ZG16
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTS
Verified Species Reactivity Human
Interspecies Identity Rat (85%), Mouse (81%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.