CacheBy
Atlas Antibodies Anti-ZBTB49 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB49 Antibody

상품 한눈에 보기

인간 ZBTB49 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, 고순도 PrEST 항원으로 정제되었습니다. 인간 및 랫트 반응성이 검증되어 다양한 생물학 연구에 활용 가능합니다.

카탈로그번호
HPA024450-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024450-100 Anti-ZBTB49 Antibody, zinc finger and BTB domain containing 49 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024450-25 Anti-ZBTB49 Antibody, zinc finger and BTB domain containing 49 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB49 Antibody

Anti-ZBTB49 Antibody

Target: zinc finger and BTB domain containing 49
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ZBTB49.


Alternative Gene Names

FLJ38559, ZNF509

Open Datasheet


Target Information

  • Target Protein: zinc finger and BTB domain containing 49
  • Target Gene: ZBTB49
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVISENYP

Verified Species Reactivity

Human, Rat

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000029127 82%
Rat ENSRNOG00000005633 79%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.