Atlas Antibodies Anti-ZBTB47 Antibody

상품 한눈에 보기

인간 ZBTB47 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광(ICC) 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적이며, 마우스 및 랫과 60% 서열 유사성. 글리세롤 기반 완충액에 보존제 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA074057-100 Anti-ZBTB47 Antibody, zinc finger and BTB domain containing 47 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA074057-25 Anti-ZBTB47 Antibody, zinc finger and BTB domain containing 47 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: zinc finger and BTB domain containing 47 (ZBTB47)
Supplier: Atlas Antibodies

면역세포화학(ICC) 등 다양한 연구용 응용에 적합

Polyclonal antibody against Human ZBTB47.

DKFZp434N0615, KIAA1190, ZNF651

Target Protein: zinc finger and BTB domain containing 47
Target Gene: ZBTB47
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EAGGKQGPRGSRSSRADPPPHSHMATRSRENARRRGTPEPEEAGRRGGKRPKPPPGVASASARG

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet