CacheBy
Atlas Antibodies Anti-ZBTB5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB5 Antibody

상품 한눈에 보기

인간 ZBTB5 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합합니다. 토끼에서 생산된 IgG 형식이며, PrEST 항원으로 정제되었습니다. 인간에 높은 특이성을 가지며, 글리세롤/PBS 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA021521-100 Anti-ZBTB5 Antibody, zinc finger and BTB domain containing 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021521-25 Anti-ZBTB5 Antibody, zinc finger and BTB domain containing 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB5 Antibody

Anti-ZBTB5 Antibody

Target: Zinc finger and BTB domain containing 5
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ZBTB5.


Alternative Gene Names

  • KIAA0354

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Zinc finger and BTB domain containing 5
Target Gene ZBTB5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (94%), Rat (93%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

GEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNN


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Material Safety Data Sheet (MSDS)


제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.