CacheBy
Atlas Antibodies Anti-ZBTB45 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB45 Antibody

상품 한눈에 보기

인간 ZBTB45 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 사용해 친화 정제되었습니다. 인간에 대해 검증되었으며, 랫 및 마우스와 79% 서열 일치를 보입니다.

카탈로그번호
HPA075485-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075485-100 Anti-ZBTB45 Antibody, zinc finger and BTB domain containing 45 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075485-25 Anti-ZBTB45 Antibody, zinc finger and BTB domain containing 45 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB45 Antibody

Anti-ZBTB45 Antibody

Target: Zinc finger and BTB domain containing 45 (ZBTB45)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human ZBTB45.


Alternative Gene Names

  • FLJ14486
  • ZNF499

Open Datasheet


Target Information

항목 내용
Target Protein Zinc finger and BTB domain containing 45
Target Gene ZBTB45
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PTLQPEAAPSTQLGEVPAPSAAPTTAPSGTPARTPGAEPPTYECSHCRKTFSSRKNYTKHMFIHSGEKPHQCAVCW

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 서열 일치율
Rat ENSRNOG00000027459 79%
Mouse ENSMUSG00000049600 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.