CacheBy
Atlas Antibodies Anti-ZBTB43 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB43 Antibody

상품 한눈에 보기

Human ZBTB43 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 다양한 종에서 높은 상동성을 보여 연구용으로 유용합니다.

카탈로그번호
HPA016825-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA016825-100 Anti-ZBTB43 Antibody, zinc finger and BTB domain containing 43 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016825-25 Anti-ZBTB43 Antibody, zinc finger and BTB domain containing 43 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB43 Antibody

Anti-ZBTB43 Antibody

Target Information

  • Target Protein: Zinc finger and BTB domain containing 43
  • Target Gene: ZBTB43
  • Alternative Gene Names: FLJ22470, KIAA0414, ZBTB22B, ZNF-X, ZNF297B

Product Description

Polyclonal antibody against human ZBTB43.
This antibody is suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSENIEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000026788 88%
Rat ENSRNOG00000017017 87%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

IHC Recommended
ICC Recommended

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.