CacheBy
Atlas Antibodies Anti-ZBTB42 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB42 Antibody

상품 한눈에 보기

인간 ZBTB42 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤과 PBS 완충액에 보존되어 있습니다. 인간에 대해 검증되었으며, 설치류와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA000703-100 Anti-ZBTB42 Antibody, zinc finger and BTB domain containing 42 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000703-25 Anti-ZBTB42 Antibody, zinc finger and BTB domain containing 42 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB42 Antibody

Anti-ZBTB42 Antibody

Zinc finger and BTB domain containing 42

면역조직화학(IHC)

Product Description

Polyclonal antibody against human ZBTB42.

Alternative Gene Names

ZNF925

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Zinc finger and BTB domain containing 42
Target Gene ZBTB42
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVRLNGDIVTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIVKVCKGRLQEKDRSLDPGNPAPGAEPAQPPC

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000037562 (82%)
  • Mouse ENSMUSG00000037638 (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.