Atlas Antibodies Anti-ZBTB42 Antibody

상품 한눈에 보기

인간 ZBTB42 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤과 PBS 완충액에 보존되어 있습니다. 인간에 대해 검증되었으며, 설치류와 높은 서열 유사성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA000703-100 Anti-ZBTB42 Antibody, zinc finger and BTB domain containing 42 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA000703-25 Anti-ZBTB42 Antibody, zinc finger and BTB domain containing 42 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Zinc finger and BTB domain containing 42

면역조직화학(IHC)

Polyclonal antibody against human ZBTB42.

ZNF925

항목	내용
Target Protein	Zinc finger and BTB domain containing 42
Target Gene	ZBTB42
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	LGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVRLNGDIVTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIVKVCKGRLQEKDRSLDPGNPAPGAEPAQPPC

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)