Atlas Antibodies Anti-ZBTB42 Antibody

상품 한눈에 보기

인간 ZBTB42 단백질을 인식하는 폴리클로날 항체입니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 적합합니다. 토끼 유래 IgG로, 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다. 인간에 대한 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA066961-100 Anti-ZBTB42 Antibody, zinc finger and BTB domain containing 42 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA066961-25 Anti-ZBTB42 Antibody, zinc finger and BTB domain containing 42 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: zinc finger and BTB domain containing 42 (ZBTB42)
Supplier: Atlas Antibodies

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Polyclonal Antibody against Human ZBTB42

항목	내용
Target Protein	zinc finger and BTB domain containing 42
Target Gene	ZBTB42
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000037562 (82%), Mouse ENSMUSG00000037638 (81%)

Antigen Sequence:

LGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVRLNGDIVTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIVKVCKGRLQEKDRSLDPGNPAPGAEPAQPPC

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)