Atlas Antibodies Anti-ZBTB37 Antibody

상품 한눈에 보기

Human ZBTB37 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며 인간, 생쥐, 랫드에 반응합니다. 연구용으로 다양한 종 간 유사성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023438-100 Anti-ZBTB37 Antibody, zinc finger and BTB domain containing 37 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023438-25 Anti-ZBTB37 Antibody, zinc finger and BTB domain containing 37 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: zinc finger and BTB domain containing 37 (ZBTB37)
Supplier: Atlas Antibodies

Polyclonal antibody against human ZBTB37.

항목	내용
Target Protein	zinc finger and BTB domain containing 37
Target Gene	ZBTB37
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PEESTSPQIIEPSSDVESREPILRINRAGQWYVETGVADRGGRSDDEVRVLGAVHIKTENLEEWLGPENQPSGEDGSSA
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000026907 (91%), Mouse ENSMUSG00000043467 (90%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.