CacheBy
Atlas Antibodies Anti-ZBTB38 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB38 Antibody

상품 한눈에 보기

Human ZBTB38 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 제조되었습니다. ICC 등 다양한 응용에 적합하며, 40% glycerol 기반 PBS buffer에 보존됩니다. Human에 대해 검증된 반응성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA059378-100 Anti-ZBTB38 Antibody, zinc finger and BTB domain containing 38 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059378-25 Anti-ZBTB38 Antibody, zinc finger and BTB domain containing 38 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB38 Antibody

Anti-ZBTB38 Antibody

Target: zinc finger and BTB domain containing 38 (ZBTB38)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ZBTB38.


Alternative Gene Names

CIBZ, FLJ35036, PPP1R171, ZNF921

Open Datasheet


Target Information

항목 내용
Target Protein zinc finger and BTB domain containing 38
Target Gene ZBTB38
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (Amino Acids) PVLSLSNSSENAASVISYSGSAPSVIVHSSQFSSVIMHSNAIAAMTSSNHRAFSDPAVSQSLKDDSKPEPDKVGRFASRPKSIKEKKKTTSHTRGEIPEESNYVADPGGSLSKTTNIAEETSKIET

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000040433 69%
Rat ENSRNOG00000012386 65%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.