CacheBy
Atlas Antibodies Anti-ZBTB39 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB39 Antibody

상품 한눈에 보기

인간 ZBTB39 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 정제됨. KIAA0352, ZNF922 등 대체 유전자명으로도 알려짐. PBS/glycerol buffer에 보존 처리됨.

카탈로그번호
HPA020306-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020306-100 Anti-ZBTB39 Antibody, zinc finger and BTB domain containing 39 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020306-25 Anti-ZBTB39 Antibody, zinc finger and BTB domain containing 39 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB39 Antibody

Anti-ZBTB39 Antibody

Target: Zinc finger and BTB domain containing 39 (ZBTB39)
Supplier: Atlas Antibodies

면역조직화학(IHC)

Product Description

Polyclonal antibody against human ZBTB39.

Alternative Gene Names

KIAA0352, ZNF922

Open Datasheet (PDF)

Target Information

  • Target Protein: Zinc finger and BTB domain containing 39
  • Target Gene: ZBTB39
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MCETKFFTQWQLTLHRRDGIFENNIIVHPNDPLPGKLGLFSGAASPELKCAACGKVLAKDFHVVRGHILDHLNLKGQACSVCDQRHLNLCSLMWHTLSHLGISV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat (ENSRNOG00000004306): 92%
  • Mouse (ENSMUSG00000044617): 88%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.