CacheBy
Atlas Antibodies Anti-ZBTB33 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB33 Antibody

상품 한눈에 보기

인간 ZBTB33 단백질을 인식하는 폴리클로날 항체로 IHC, WB, ICC에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적으로 반응하며, 실험 전 부드럽게 혼합 후 사용을 권장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA000755-100 Anti-ZBTB33 Antibody, zinc finger and BTB domain containing 33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000755-25 Anti-ZBTB33 Antibody, zinc finger and BTB domain containing 33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB33 Antibody

Anti-ZBTB33 Antibody

Target: Zinc finger and BTB domain containing 33 (ZBTB33)
Type: Polyclonal Antibody against Human ZBTB33


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human ZBTB33 protein.


Alternative Gene Names

kaiso, WUGSC:H_DJ525N14.1, ZNF-kaiso, ZNF348

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Zinc finger and BTB domain containing 33
Target Gene ZBTB33
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000046156 (81%), Mouse ENSMUSG00000048047 (81%)

Antigen Sequence

IAELGVPLSQVKSISGTAQDGNTEPLPPDSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEMKKIIVTDSDDDDDDVIFCSEILPTKETLPSNNTVAQVQSNPGPVAISD

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.