CacheBy
Atlas Antibodies Anti-ZBED8 Antibody
원본

Atlas Antibodies Anti-ZBED8 Antibody

상품 한눈에 보기

Human ZBED8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 기반 PBS 버퍼에 보존되어 있습니다. Buster3, C5orf54 유전자 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA045445-100 Anti-ZBED8 Antibody, zinc finger, BED-type containing 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045445-25 Anti-ZBED8 Antibody, zinc finger, BED-type containing 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBED8 Antibody

Anti-ZBED8 Antibody

Target: zinc finger, BED-type containing 8 (ZBED8)
Type: Polyclonal Antibody against Human ZBED8
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

This is a polyclonal antibody raised in rabbit against the human ZBED8 protein. It is affinity purified using the PrEST antigen as the affinity ligand.


Alternative Gene Names

  • Buster3
  • C5orf54

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein zinc finger, BED-type containing 8
Target Gene ZBED8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLNELSASMQRTGMNTVSAREKLSAFVRKFPFWQKRIEKRNFTNFPFLEEIIVSDNEGIFIAAEITLHL

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Identity
Rat ENSRNOG00000013865 33%
Mouse ENSMUSG00000042408 32%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and experimental conditions should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.