
원본
Atlas Antibodies Anti-ZBED8 Antibody
상품 한눈에 보기
Human ZBED8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 기반 PBS 버퍼에 보존되어 있습니다. Buster3, C5orf54 유전자 연구에 활용 가능합니다.
- 카탈로그번호
- HPA045445-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA045445-100 Anti-ZBED8 Antibody, zinc finger, BED-type containing 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045445-25 Anti-ZBED8 Antibody, zinc finger, BED-type containing 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZBED8 Antibody
Anti-ZBED8 Antibody
Target: zinc finger, BED-type containing 8 (ZBED8)
Type: Polyclonal Antibody against Human ZBED8
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This is a polyclonal antibody raised in rabbit against the human ZBED8 protein. It is affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
- Buster3
- C5orf54
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger, BED-type containing 8 |
| Target Gene | ZBED8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLNELSASMQRTGMNTVSAREKLSAFVRKFPFWQKRIEKRNFTNFPFLEEIIVSDNEGIFIAAEITLHL |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000013865 | 33% |
| Mouse | ENSMUSG00000042408 | 32% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and experimental conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



