CacheBy
Atlas Antibodies Anti-ZBED6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBED6 Antibody

상품 한눈에 보기

인간 ZBED6 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 사용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 글리세롤 및 PBS 완충액에 보존되어 있습니다.

카탈로그번호
HPA068807-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068807-100 Anti-ZBED6 Antibody, zinc finger, BED-type containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068807-25 Anti-ZBED6 Antibody, zinc finger, BED-type containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBED6 Antibody

Anti-ZBED6 Antibody

Target Protein: zinc finger BED-type containing 6
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ZBED6.
Open Datasheet

Target Information

  • Target Gene: ZBED6
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    TLSTKQGEEPLVRLSLTERLGKRKFSAGGDSDPPLKRSLAQRLGKKVEAPETNIDKTPKKAQVSKSLKERLGMSADPDNEDATDKVNKVGEIHVK
  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000053210 (65%)
    • Mouse ENSMUSG00000102976 (62%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.