CacheBy
Atlas Antibodies Anti-ZBTB10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB10 Antibody

상품 한눈에 보기

인간 ZBTB10 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC 적용에 적합하며, RNA-seq 데이터 기반 정교한 직교 검증을 거쳤습니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA021554-100 Anti-ZBTB10 Antibody, zinc finger and BTB domain containing 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021554-25 Anti-ZBTB10 Antibody, zinc finger and BTB domain containing 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB10 Antibody

Anti-ZBTB10 Antibody

Target: zinc finger and BTB domain containing 10 (ZBTB10)
Type: Polyclonal Antibody against Human ZBTB10


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human ZBTB10 protein.


Alternative Gene Names

  • FLJ12752
  • RINZF

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein zinc finger and BTB domain containing 10
Target Gene ZBTB10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SSWVQDGSPEMAENESEGQTKVFIWNNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLIKEEPDLDGALLSGPD
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000061862 (83%), Mouse ENSMUSG00000069114 (80%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.