CacheBy
Atlas Antibodies Anti-ZBED6CL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBED6CL Antibody

상품 한눈에 보기

Human ZBED6CL 단백질을 인식하는 토끼 다클론 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원을 이용해 친화 정제된 고품질 항체이며, 인체 시료에 적합. 다양한 연구 응용에 최적화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA055805-100 Anti-ZBED6CL Antibody, ZBED6 C-terminal like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055805-25 Anti-ZBED6CL Antibody, ZBED6 C-terminal like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBED6CL Antibody

Anti-ZBED6CL Antibody

ZBED6 C-terminal like


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against Human ZBED6CL


Alternative Gene Names

  • C7orf29

Open Datasheet


Target Information

항목 내용
Target Protein ZBED6 C-terminal like
Target Gene ZBED6CL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSHSG
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000009448 (30%), Mouse ENSMUSG00000029059 (29%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 따라 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.