CacheBy
Atlas Antibodies Anti-ZBED6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBED6 Antibody

상품 한눈에 보기

인간 ZBED6 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 실험에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫과 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA026439-100 Anti-ZBED6 Antibody, zinc finger BED-type containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026439-25 Anti-ZBED6 Antibody, zinc finger BED-type containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBED6 Antibody

Anti-ZBED6 Antibody

Target: zinc finger BED-type containing 6
Type: Polyclonal Antibody against Human ZBED6

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human ZBED6.
Affinity purified using the PrEST antigen as affinity ligand.
Open Datasheet (PDF)

Target Information

항목 내용
Target Protein zinc finger BED-type containing 6
Target Gene ZBED6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TLSTKQGEEPLVRLSLTERLGKRKFSAGGDSDPPLKRSLAQRLGKKVEAPETNIDKTPKKAQVSKSLKERLGMSADPDNEDATDKVNKVGEIHVK
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000053210 (65%), Mouse ENSMUSG00000102976 (62%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (MSDS)
Purification Method Affinity purified using PrEST antigen

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC icon
WB icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.