CacheBy
Atlas Antibodies Anti-ZBED6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBED6 Antibody

상품 한눈에 보기

인간 ZBED6 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. IHC 및 WB 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 높은 특이성과 재현성을 제공하여 연구용으로 최적화된 제품입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA028490-100 Anti-ZBED6 Antibody, zinc finger BED-type containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028490-25 Anti-ZBED6 Antibody, zinc finger BED-type containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBED6 Antibody

Anti-ZBED6 Antibody

Target: zinc finger BED-type containing 6 (ZBED6)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ZBED6.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein zinc finger BED-type containing 6
Target Gene ZBED6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000053210 (65%), Mouse ENSMUSG00000102976 (62%)

Antigen Sequence:
TLSTKQGEEPLVRLSLTERLGKRKFSAGGDSDPPLKRSLAQRLGKKVEAPETNIDKTPKKAQVSKSLKERLGMSADPDNEDATDKVNKVGEIHVK


Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.