CacheBy
Atlas Antibodies Anti-XPO6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-XPO6 Antibody

상품 한눈에 보기

Human XPO6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. PBS와 글리세롤 버퍼에 보존되어 안정적입니다.

카탈로그번호
HPA038246-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038246-100 Anti-XPO6 Antibody, exportin 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038246-25 Anti-XPO6 Antibody, exportin 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-XPO6 Antibody

Anti-XPO6 Antibody

Target Information

  • Target Protein: exportin 6
  • Target Gene: XPO6
  • Alternative Gene Names: FLJ22519, KIAA0370, RANBP20

Product Description

Polyclonal antibody against human XPO6, suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    RPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFSAIMQAFGQSFLQPDIHLFKQNLFYLETLNTKQKLYHKK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000000131 100%
Rat ENSRNOG00000016722 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Storage & Handling Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.