CacheBy
Atlas Antibodies Anti-XPC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-XPC Antibody

상품 한눈에 보기

인간 XPC 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Rabbit 호스트, IgG 아이소타입, 인간 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035707-100 Anti-XPC Antibody, xeroderma pigmentosum, complementation group C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035707-25 Anti-XPC Antibody, xeroderma pigmentosum, complementation group C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-XPC Antibody

Anti-XPC Antibody

Target Information

  • Target Protein: xeroderma pigmentosum, complementation group C
  • Target Gene: XPC
  • Alternative Gene Names: RAD4, XPCC

Product Description

Polyclonal Antibody against Human XPC

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EEEDAFEDEKPPKKSLLSKVSQGKRKRGCSHPGGSADGPAKKKVAKVTVKSENLKVIKDEALSDGDDLRDFPSDLKKAHHLKRGATMNEDSNEEEEESENDW

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000030094 59%
Rat ENSRNOG00000008274 58%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.