CacheBy
Atlas Antibodies Anti-IGSF11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IGSF11 Antibody

상품 한눈에 보기

Human IGSF11 단백질을 인식하는 고품질 Polyclonal Rabbit IgG 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증 완료. PrEST 항원으로 친화 정제된 고특이성 제품.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046377-100 Anti-IGSF11 Antibody, immunoglobulin superfamily, member 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046377-25 Anti-IGSF11 Antibody, immunoglobulin superfamily, member 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IGSF11 Antibody

Anti-IGSF11 Antibody

Target: Immunoglobulin superfamily, member 11 (IGSF11)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Orthogonal validation using RNA-seq data comparison in high and low expression cell lines
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human IGSF11


Alternative Gene Names

BT-IgSF, CT119, Igsf13, MGC35227, VSIG3

Open Datasheet


Target Information

항목 내용
Target Protein Immunoglobulin superfamily, member 11
Target Gene IGSF11
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGNANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000022790): 84%
  • Rat (ENSRNOG00000001525): 84%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.