CacheBy
Atlas Antibodies Anti-IGSF10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IGSF10 Antibody

상품 한눈에 보기

Human IGSF10 단백질을 표적으로 하는 토끼 다클론 항체. ICC 등 면역실험에 적합하며, PrEST 항원으로 특이적 정제됨. 인간에 반응하며, 마우스·랫과도 높은 상동성 보유. 안정한 PBS/glycerol 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012921-100 Anti-IGSF10 Antibody, immunoglobulin superfamily, member 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012921-25 Anti-IGSF10 Antibody, immunoglobulin superfamily, member 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IGSF10 Antibody

Anti-IGSF10 Antibody

Target Information

  • Target Protein: Immunoglobulin superfamily member 10
  • Target Gene: IGSF10
  • Alternative Gene Names: CMF608, FLJ25972
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human IGSF10.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AQITLPRAEMRPVKHKWTMISRDNNTKLEHTVLVGGTVGLNCPGQGDPTPHVDWLLADGSKVRAPYVSEDGRILIDKSGKLELQMADSFDTGVYHCISSNYDDADILTYRITVVEPLVEAYQENGIHHTVFIGETLDLPCHSTGIP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000036334): 79%
  • Rat (ENSRNOG00000013917): 75%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.