CacheBy
Atlas Antibodies Anti-IGSF22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IGSF22 Antibody

상품 한눈에 보기

인간 IGSF22 단백질을 인식하는 폴리클로날 항체로, 면역글로불린 초족 멤버 22를 표적으로 함. 토끼에서 생산된 IgG 항체이며, 높은 특이성과 재현성을 제공. 다양한 면역학적 응용에 적합하며, 친화 정제된 고품질 시약.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037851-100 Anti-IGSF22 Antibody, immunoglobulin superfamily member 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037851-25 Anti-IGSF22 Antibody, immunoglobulin superfamily member 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IGSF22 Antibody

Anti-IGSF22 Antibody

Target Information

  • Target Protein: Immunoglobulin superfamily member 22
  • Target Gene: IGSF22
  • Alternative Gene Names: FLJ37794, IGFN2

Product Description

Polyclonal antibody against human IGSF22.

ICC (Immunocytochemistry)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKY

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000051985 38%
Rat ENSRNOG00000026087 33%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.