Atlas Antibodies Anti-HTR4 Antibody

상품 한눈에 보기

인간 HTR4 단백질을 타깃으로 하는 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원으로 친화 정제되었습니다. 40% 글리세롤 PBS 버퍼에 나트륨 아지드 보존제가 포함되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040591-100 Anti-HTR4 Antibody, 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040591-25 Anti-HTR4 Antibody, 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human HTR4

항목	내용
Target Protein	5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled
Target Gene	HTR4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000026322 (91%) Rat ENSRNOG00000019134 (88%)

FRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSD

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet