CacheBy
Atlas Antibodies Anti-HTRA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HTRA2 Antibody

상품 한눈에 보기

인간 HTRA2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 정제됨. 인간에 높은 반응성을 보이며, Rat 및 Mouse에서도 높은 상동성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006602-100 Anti-HTRA2 Antibody, HtrA serine peptidase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006602-25 Anti-HTRA2 Antibody, HtrA serine peptidase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HTRA2 Antibody

Anti-HTRA2 Antibody

Target Information

  • Target Protein: HtrA serine peptidase 2
  • Target Gene: HTRA2
  • Alternative Gene Names: OMI, PARK13, PRSS25

Product Description

Polyclonal Antibody against Human HTRA2

ICC (Immunocytochemistry)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    RLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSP

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000022448 95%
Mouse ENSMUSG00000068329 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.