Atlas Antibodies Anti-HTR3B Antibody

상품 한눈에 보기

인체 HTR3B 단백질을 표적으로 하는 토끼 폴리클로날 항체. 면역조직화학 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 대한 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039559-100 Anti-HTR3B Antibody, 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039559-25 Anti-HTR3B Antibody, 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic
Type: Polyclonal Antibody against Human HTR3B

Polyclonal antibody raised in rabbit against the human HTR3B protein (5-hydroxytryptamine receptor 3B, ionotropic).

항목	내용
Target Protein	5-hydroxytryptamine (serotonin) receptor 3B, ionotropic
Target Gene	HTR3B
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000006920 (51%), Mouse ENSMUSG00000008590 (48%)

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Antigen Sequence:
FLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSR

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet