
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HTR3B Antibody
상품 한눈에 보기
인체 HTR3B 단백질을 표적으로 하는 토끼 폴리클로날 항체. 면역조직화학 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 대한 반응성이 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039559-100 Anti-HTR3B Antibody, 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039559-25 Anti-HTR3B Antibody, 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HTR3B Antibody
Anti-HTR3B Antibody
Target: 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic
Type: Polyclonal Antibody against Human HTR3B
Recommended Applications
- Immunohistochemistry (IHC)
- Other standard antibody-based assays
Product Description
Polyclonal antibody raised in rabbit against the human HTR3B protein (5-hydroxytryptamine receptor 3B, ionotropic).
Alternative Gene Names
- 5-HT3B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic |
| Target Gene | HTR3B |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000006920 (51%), Mouse ENSMUSG00000008590 (48%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
FLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSR
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



