CacheBy
Thermo Fisher Scientific ARHGDIG Monoclonal Antibody (1D11)
원본

Thermo Fisher Scientific ARHGDIG Monoclonal Antibody (1D11)

상품 한눈에 보기

ARHGDIG 단백질을 인식하는 Mouse monoclonal antibody(클론 1D11). Human 시료에 반응하며 WB 및 ELISA에 적합. GST-tagged full-length recombinant protein을 면역원으로 사용. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Thermo Fisher Scientific H00000398-M01 ARHGDIG Monoclonal Antibody (1D11) 100 ug pk판매 단위 pk
재고 확인 필요
518,100원VAT 포함 569,910원

Thermo Fisher Scientific · Thermo Fisher Scientific ARHGDIG Monoclonal Antibody (1D11)

Applications

Western Blot (WB)

  • Tested Dilution: 1–5 µg/mL

ELISA

  • Tested Dilution: 3 ng/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Mouse / IgG2a, kappa
Class Monoclonal
Type Antibody
Clone 1D11
Immunogen ARHGDIG (AAH47699, 1–225 a.a) full-length recombinant protein with GST tag (MW of GST tag alone: 26 kDa)
Conjugate Unconjugated
Form Liquid
Concentration See Label
Purification Affinity chromatography
Storage Buffer PBS, pH 7.4
Contains No preservative
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Ambient (domestic); Wet ice (international)

Product Specific Information

Protein Sequence:

MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD

Target Information

The Ras superfamily of small GTP-binding proteins are key mediators in cell signaling pathways regulating proliferation, cytoskeletal organization, and secretion. Their activity is modulated by GTPase regulators: guanine nucleotide-releasing factors (GRFs) that increase GDP dissociation, and GDP-dissociation inhibitors (GDIs) that decrease it.
The Rho GDI subfamily includes Rho GDIα, Ly-GDI (Rho GDIβ), and Rho GDIγ, which interact with Ras-like GTP-binding proteins such as Rho A, Rho B, Rac, and Cdc42. Ly-GDI is expressed mainly in hematopoietic cells, particularly B and T lymphocytes.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.