
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HEY2 Antibody
상품 한눈에 보기
Human HEY2 단백질을 인식하는 Rabbit Polyclonal 항체로, bHLH 전사인자 연구에 적합. Affinity purification 방식으로 제조되었으며, Human에 대해 검증됨. 다양한 응용 분야에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA074851-100 Anti-HEY2 Antibody, hes-related family bHLH transcription factor with YRPW motif 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074851-25 Anti-HEY2 Antibody, hes-related family bHLH transcription factor with YRPW motif 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HEY2 Antibody
Anti-HEY2 Antibody
hes-related family bHLH transcription factor with YRPW motif 2
Recommended Applications
면역세포화학(ICC) 등 다양한 연구용 응용에 적합
Product Description
Polyclonal Antibody against Human HEY2
Alternative Gene Names
bHLHb32, HERP1, HESR2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | hes-related family bHLH transcription factor with YRPW motif 2 |
| Target Gene | HEY2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000013364 | 90% |
| Mouse | ENSMUSG00000019789 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



